Lineage for d4e3ba_ (4e3b A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786490Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2786491Protein automated matches [190436] (9 species)
    not a true protein
  7. 2786505Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. 2786534Domain d4e3ba_: 4e3b A: [234354]
    automated match to d3dj3b_

Details for d4e3ba_

PDB Entry: 4e3b (more details), 1.5 Å

PDB Description: crystal structure of tax-interacting protein-1 (tip-1) pdz domain bound to ical36-l (ansrwptsil) peptide
PDB Compounds: (A:) tax1-binding protein 3

SCOPe Domain Sequences for d4e3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e3ba_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeiag
lqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq

SCOPe Domain Coordinates for d4e3ba_:

Click to download the PDB-style file with coordinates for d4e3ba_.
(The format of our PDB-style files is described here.)

Timeline for d4e3ba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4e3bb_