SCOPe 2.08: Domain d4e2ca_: 4e2c A:

Lineage for d4e2ca_ (4e2c A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.60: Bacterial polysaccharide co-polymerase-like [160355] (1 family)
   Decorated common fold with extra helical regions, which facilitate oligomerization

5. Family d.58.60.1: FepE-like [160356] (4 proteins)
   the ferredoxin-like fold resides mainly on in the N-terminal part that corresponds to Pfam PF02706 (Wzz)

6. Protein automated matches [195727] (2 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [195728] (5 PDB entries)

8. Domain d4e2ca_: 4e2c A: [234353]
   automated match to d4e2cb_

Details for d4e2ca_

PDB Entry: 4e2c, 2.8 Å

PDB Description: crystal structure of the periplasmic domain of the chimeric lps o- antigen chain length regulator protein

PDB Compounds: (A:) Chimeric WzzB chain length determinant protein

SCOPe Domain Sequences for d4e2ca_:

Sequence, based on SEQRES records:

>d4e2ca_ d.58.60.1 (A:) automated matches {Shigella flexneri [TaxId: 623]}
kwtstaiitqpdvgqiagynnamnviygqaapkvsdlqetligrfssafsalaetldnqe
epekltiepsvknqqlpltvsyvgqtaegaqmklaqyiqqvddkvnqelekdlkdnialg
rknlqdslrtqevvaqeqkdlrirqiqealqyanqaqvtkpqvqqtedvtqdtlfllgse
alesmikheatrplvfspnyyqtkqtlldiknlkvtadtvhvyryvmkptlpvrrds

Sequence, based on observed residues (ATOM records):

>d4e2ca_ d.58.60.1 (A:) automated matches {Shigella flexneri [TaxId: 623]}
kwtstaiitqpdvgqiagynnamnviygqaapkvsdlqetligrfssafsalaetldnqe
epekltiepsvlpltvsyvgqtaegaqmklaqyiqqvddkvnqelekdlkdnialgrknl
qdslrtqevvaqeqkdlrirqiqealqyanqaqvtkpqvqqtedvtqdtlfllgseales
mikheatrplvfspnyyqtkqtlldiknlkvtadtvhvyryvmkptlpvrrds

Timeline for d4e2ca_:

• d4e2ca_ first appeared in SCOPe 2.03
  
• d4e2ca_ appears in SCOPe 2.07