![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
![]() | Protein Poliovirus coat proteins [49666] (3 species) |
![]() | Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries) |
![]() | Domain d1piv1_: 1piv 1: [23435] complexed with myr, w71 |
PDB Entry: 1piv (more details), 2.9 Å
SCOPe Domain Sequences for d1piv1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1piv1_ b.121.4.1 (1:) Poliovirus coat proteins {Poliovirus type 3, strain Sabin [TaxId: 12086]} qdslpdtkasgpahskevpaltavetgatnplapsdtvqtrhvvqrrsrsestiesffar gacvaiievdneqpttraqklfamwritykdtvqlrrklefftysrfdmeftfvvtanft nannghalnqvyqimyippgaptpkswddytwqtssnpsifytygaaparisvpyvglan ayshfydgfakvplktdandqigdslysamtvddfgvlavrvvndhnptkvtskvriymk pkhvrvwcprppravpyygpgvdyrnnldplsekgltty
Timeline for d1piv1_: