Lineage for d4dz6a_ (4dz6 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415050Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1415512Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 1415513Protein automated matches [191087] (7 species)
    not a true protein
  7. 1415557Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226296] (2 PDB entries)
  8. 1415558Domain d4dz6a_: 4dz6 A: [234345]
    automated match to d4di6d_
    complexed with adp, edo, vn4, vo4

Details for d4dz6a_

PDB Entry: 4dz6 (more details), 2.2 Å

PDB Description: transition state mimic of nucleoside-diphosphate kinase from borrelia burgdorferi with bound vanadate and adp
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4dz6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dz6a_ d.58.6.0 (A:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
smllqktlcivkpdgvrrgligdvvsrfervglkmvaakmlivdeslakkhylyddivfr
hseavwnslikfisnspvftfvvegvesievvrklcgatepklaipgtirgdfsyhsfky
snekgfsiynvihasaneadamreipiwfkdneilnykrddecehyyc

SCOPe Domain Coordinates for d4dz6a_:

Click to download the PDB-style file with coordinates for d4dz6a_.
(The format of our PDB-style files is described here.)

Timeline for d4dz6a_: