SCOPe 2.03: Domain d4dxef_: 4dxe F:

Lineage for d4dxef_ (4dxe F:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [226319] (2 PDB entries)

8. Domain d4dxef_: 4dxe F: [234344]
   automated match to d4dxed_
   complexed with mli

Details for d4dxef_

PDB Entry: 4dxe, 2.51 Å

PDB Description: 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col

PDB Compounds: (F:) acyl-carrier-protein synthase

SCOPe Domain Sequences for d4dxef_:

Sequence, based on SEQRES records:

>d4dxef_ d.150.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 93062]}
namihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatk
eafskalgtglgkhvafndidcyndelgkpkidyegfivhvsishtehyamsqvvleks

Sequence, based on observed residues (ATOM records):

>d4dxef_ d.150.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 93062]}
namihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatk
eafskalgtgkhvafndidcynkpkidyegfivhvsishtehyamsqvvleks

Timeline for d4dxef_:

• d4dxef_ is new in SCOPe 2.03-stable
  
• d4dxef_ appears in SCOPe 2.04
  
• d4dxef_ appears in the current release, SCOPe 2.08, called d4dxef1