SCOPe 2.08: Domain d4dv8a1: 4dv8 A:265-550

Lineage for d4dv8a1 (4dv8 A:265-550)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein automated matches [190133] (8 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234339] (15 PDB entries)

8. Domain d4dv8a1: 4dv8 A:265-550 [234340]
   Other proteins in same PDB: d4dv8a2
   automated match to d1j7na3
   complexed with 0lx, mli, zn

Details for d4dv8a1

PDB Entry: 4dv8, 1.63 Å

PDB Description: anthrax lethal factor metalloproteinase in complex with the hydroxamic acid based small molecule pt8421

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d4dv8a1:

Sequence; same for both SEQRES and ATOM records:

>d4dv8a1 d.166.1.1 (A:265-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
lsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqi
dssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiq
pydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmnin
nltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriq
lspdtragylengklilqrnigleikdvqiikqsekeyiridakvv

Timeline for d4dv8a1:

• d4dv8a1 first appeared in SCOPe 2.03
  
• d4dv8a1 appears in SCOPe 2.07