Lineage for d4ds2a_ (4ds2 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898682Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1898683Protein automated matches [190120] (6 species)
    not a true protein
  7. 1898716Species Trypanosoma cruzi [TaxId:5693] [234333] (1 PDB entry)
  8. 1898717Domain d4ds2a_: 4ds2 A: [234334]
    automated match to d3fn1b_

Details for d4ds2a_

PDB Entry: 4ds2 (more details), 2.63 Å

PDB Description: ubiquitin conjugating enzyme (putative) from trypanosoma cruzi
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2, putative

SCOPe Domain Sequences for d4ds2a_:

Sequence, based on SEQRES records: (download)

>d4ds2a_ d.20.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mknisnkriikdlkllleevdanneanssgsphstaifsvdtdtiynwilkvkapadsvy
ggagntyqlsvlfsddyphepptvrfvtpvysplvtgeggicdrmvndfwtpdqhasdvi
klvldrvfsqyksrrdddvnpearhylekfpqdfaarvrrg

Sequence, based on observed residues (ATOM records): (download)

>d4ds2a_ d.20.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mknisnkriikdlkllleevdanneasphstaifsvdtdtiynwilkvkapadsvyggag
ntyqlsvlfsddyphepptvrfvtpvysplvtgeggicdrmvndfwtpdqhasdviklvl
drvfsqyksrrdddvnpearhylekfpqdfaarvrrg

SCOPe Domain Coordinates for d4ds2a_:

Click to download the PDB-style file with coordinates for d4ds2a_.
(The format of our PDB-style files is described here.)

Timeline for d4ds2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ds2b_