![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
![]() | Protein automated matches [190120] (9 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:5693] [234333] (1 PDB entry) |
![]() | Domain d4ds2a_: 4ds2 A: [234334] automated match to d3fn1b_ |
PDB Entry: 4ds2 (more details), 2.63 Å
SCOPe Domain Sequences for d4ds2a_:
Sequence, based on SEQRES records: (download)
>d4ds2a_ d.20.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} mknisnkriikdlkllleevdanneanssgsphstaifsvdtdtiynwilkvkapadsvy ggagntyqlsvlfsddyphepptvrfvtpvysplvtgeggicdrmvndfwtpdqhasdvi klvldrvfsqyksrrdddvnpearhylekfpqdfaarvrrg
>d4ds2a_ d.20.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} mknisnkriikdlkllleevdanneasphstaifsvdtdtiynwilkvkapadsvyggag ntyqlsvlfsddyphepptvrfvtpvysplvtgeggicdrmvndfwtpdqhasdviklvl drvfsqyksrrdddvnpearhylekfpqdfaarvrrg
Timeline for d4ds2a_: