Lineage for d4dkab1 (4dka B:6-127)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2356021Domain d4dkab1: 4dka B:6-127 [234328]
    Other proteins in same PDB: d4dkaa2, d4dkab2
    automated match to d1qd0a_
    protein/RNA complex; complexed with na

Details for d4dkab1

PDB Entry: 4dka (more details), 1.97 Å

PDB Description: structure of editosome protein
PDB Compounds: (B:) single domain antibody VHH

SCOPe Domain Sequences for d4dkab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dkab1 b.1.1.1 (B:6-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtsslysmgwfrqapgkerefvaaisrngantyytdsvk
grftisrdnakntvelqmnslkpedtavyycaadrfptmevvtimtneydywgqgtqvtv
ss

SCOPe Domain Coordinates for d4dkab1:

Click to download the PDB-style file with coordinates for d4dkab1.
(The format of our PDB-style files is described here.)

Timeline for d4dkab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dkab2