SCOPe 2.08: Domain d4dkab1: 4dka B:6-127

Lineage for d4dkab1 (4dka B:6-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4dkab1: 4dka B:6-127 [234328]
   Other proteins in same PDB: d4dkaa2, d4dkab2
   automated match to d1qd0a_
   protein/RNA complex; complexed with na

Details for d4dkab1

PDB Entry: 4dka, 1.97 Å

PDB Description: structure of editosome protein

PDB Compounds: (B:) single domain antibody VHH

SCOPe Domain Sequences for d4dkab1:

Sequence; same for both SEQRES and ATOM records:

>d4dkab1 b.1.1.1 (B:6-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtsslysmgwfrqapgkerefvaaisrngantyytdsvk
grftisrdnakntvelqmnslkpedtavyycaadrfptmevvtimtneydywgqgtqvtv
ss

Timeline for d4dkab1:

• d4dkab1 first appeared in SCOPe 2.03, called d4dkab_
  
• d4dkab1 appears in SCOPe 2.07