SCOPe 2.04: Domain d4dk3a_: 4dk3 A:

Lineage for d4dk3a_ (4dk3 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries)

8. Domain d4dk3a_: 4dk3 A: [234327]
   automated match to d1qd0a_
   protein/RNA complex

Details for d4dk3a_

PDB Entry: 4dk3, 2.76 Å

PDB Description: structure of editosome protein

PDB Compounds: (A:) single domain antibody VHH

SCOPe Domain Sequences for d4dk3a_:

Sequence; same for both SEQRES and ATOM records:

>d4dk3a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgrtsslysmgwfrqapgkerefvaaisrngantyy
tdsvkgrftisrdnakntvelqmnslkpedtavyycaadrfptmevvtimtneydywgqg
tqvtvss

Timeline for d4dk3a_:

• d4dk3a_ first appeared in SCOPe 2.03
  
• d4dk3a_ appears in SCOPe 2.05
  
• d4dk3a_ appears in the current release, SCOPe 2.08, called d4dk3a1