Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225017] (6 PDB entries) |
Domain d4dipe_: 4dip E: [234322] automated match to d2y78a_ complexed with na, po4 |
PDB Entry: 4dip (more details), 1.82 Å
SCOPe Domain Sequences for d4dipe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dipe_ d.26.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} galipepevkievlqkpfichrktkggdlmlvhyegylekdgslfhsthkhnngqpiwft lgilealkgwdqglkgmcvgekrkliippalgygkegkgkippestlifnidlleirngp
Timeline for d4dipe_:
View in 3D Domains from other chains: (mouse over for more information) d4dipa_, d4dipb_, d4dipc_, d4dipd_ |