SCOPe 2.03: Domain d4dipb_: 4dip B:

Lineage for d4dipb_ (4dip B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (6 PDB entries)

8. Domain d4dipb_: 4dip B: [234320]
   automated match to d2y78a_
   complexed with na, po4

Details for d4dipb_

PDB Entry: 4dip, 1.82 Å

PDB Description: Crystal structure of human Peptidyl-prolyl cis-trans isomerase FKBP14

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP14

SCOPe Domain Sequences for d4dipb_:

Sequence; same for both SEQRES and ATOM records:

>d4dipb_ d.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgalipepevkievlqkpfichrktkggdlmlvhyegylekdgslfhsthkhnngqpiwf
tlgilealkgwdqglkgmcvgekrkliippalgygkegkgkippestlifnidlleirng
p

Timeline for d4dipb_:

• d4dipb_ is new in SCOPe 2.03-stable
  
• d4dipb_ appears in SCOPe 2.04
  
• d4dipb_ appears in the current release, SCOPe 2.08, called d4dipb1