Lineage for d4dipb_ (4dip B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408627Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1408628Protein automated matches [191162] (11 species)
    not a true protein
  7. 1408643Species Human (Homo sapiens) [TaxId:9606] [225017] (6 PDB entries)
  8. 1408647Domain d4dipb_: 4dip B: [234320]
    automated match to d2y78a_
    complexed with na, po4

Details for d4dipb_

PDB Entry: 4dip (more details), 1.82 Å

PDB Description: Crystal structure of human Peptidyl-prolyl cis-trans isomerase FKBP14
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP14

SCOPe Domain Sequences for d4dipb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dipb_ d.26.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgalipepevkievlqkpfichrktkggdlmlvhyegylekdgslfhsthkhnngqpiwf
tlgilealkgwdqglkgmcvgekrkliippalgygkegkgkippestlifnidlleirng
p

SCOPe Domain Coordinates for d4dipb_:

Click to download the PDB-style file with coordinates for d4dipb_.
(The format of our PDB-style files is described here.)

Timeline for d4dipb_: