Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
Protein automated matches [191113] (5 species) not a true protein |
Species Clostridium thermocellum [TaxId:203119] [194259] (4 PDB entries) |
Domain d4dh2c_: 4dh2 C: [234315] automated match to d3ul4a_ complexed with ca, so4 |
PDB Entry: 4dh2 (more details), 1.75 Å
SCOPe Domain Sequences for d4dh2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dh2c_ b.2.2.0 (C:) automated matches {Clostridium thermocellum [TaxId: 203119]} heaetadyildvlvegvkakagdtveiplkfenvpshgiqsfnlslyydskaievlkvep gsiitdpannfdynivykdseivflfdddkqkgegliktdgvfakltvrikpdifkdsgs tkkyslitfgesnfcdfdlkpilavlkegkveiekl
Timeline for d4dh2c_: