SCOPe 2.04: Domain d4dh2a_: 4dh2 A:

Lineage for d4dh2a_ (4dh2 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (6 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [194259] (4 PDB entries)

8. Domain d4dh2a_: 4dh2 A: [234314]
   automated match to d3ul4a_
   complexed with ca, so4

Details for d4dh2a_

PDB Entry: 4dh2, 1.75 Å

PDB Description: Crystal structure of Coh-OlpC(Cthe_0452)-Doc435(Cthe_0435) complex: A novel type I Cohesin-Dockerin complex from Clostridium thermocellum ATTC 27405

PDB Compounds: (A:) Cellulosome anchoring protein cohesin region

SCOPe Domain Sequences for d4dh2a_:

Sequence; same for both SEQRES and ATOM records:

>d4dh2a_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]}
iheaetadyildvlvegvkakagdtveiplkfenvpshgiqsfnlslyydskaievlkve
pgsiitdpannfdynivykdseivflfdddkqkgegliktdgvfakltvrikpdifkdsg
stkkyslitfgesnfcdfdlkpilavlkegkveiekle

Timeline for d4dh2a_:

• d4dh2a_ first appeared in SCOPe 2.03
  
• d4dh2a_ appears in SCOPe 2.05
  
• d4dh2a_ appears in the current release, SCOPe 2.08, called d4dh2a1