Lineage for d1vbe3_ (1vbe 3:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) 
Protein Poliovirus [49666] (3 species) Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries) 
Domain d1vbe3_: 1vbe 3: [23431]
Details for d1vbe3_
PDB Entry: 1vbe (more details), 2.8 Å
PDB Description: poliovirus (type 3, sabin strain, mutant 242-h2) complexed with r78206
SCOP Domain Sequences for d1vbe3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbe3_ b.10.1.4 (3:) Poliovirus {Poliovirus type 3, strain Sabin}
glpvlntpgsnqyltsdnhqspcaipefdvtppidipgevknmmelaeidtmiplnlest
krntmdmyrvtlsdsadlsqpilclslspafdprlshtmlgevlnyythwagslkftflf
cgsmmatgkilvayappgaqpptsrkeamlgthviwdlglqssctmvvpwisnvtyrqtt
qdsfteggyismfyqtrivvplstpksmsmlgfvsacndfsvrllrdtthisqsa
SCOP Domain Coordinates for d1vbe3_:
Click to download the PDB-style file with coordinates for d1vbe3_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vbe3_:
- d1vbe3_ appears in SCOP 1.57
- d1vbe3_ appears in the current release, SCOPe 2.08
View in 3D
