SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1vbe3_ (1vbe 3:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2075627Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 protein domains)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2075683Protein Poliovirus coat proteins [49666] (3 species)
  7. 2075723Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries)
  8. 2075735Domain d1vbe3_: 1vbe 3: [23431]
    complexed with j78, myr; mutant

Details for d1vbe3_

PDB Entry: 1vbe (more details), 2.8 Å

PDB Description: poliovirus (type 3, sabin strain, mutant 242-h2) complexed with r78206
PDB Compounds: (3:) poliovirus type 3

SCOPe Domain Sequences for d1vbe3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbe3_ b.121.4.1 (3:) Poliovirus coat proteins {Poliovirus type 3, strain Sabin [TaxId: 12086]}
glpvlntpgsnqyltsdnhqspcaipefdvtppidipgevknmmelaeidtmiplnlest
krntmdmyrvtlsdsadlsqpilclslspafdprlshtmlgevlnyythwagslkftflf
cgsmmatgkilvayappgaqpptsrkeamlgthviwdlglqssctmvvpwisnvtyrqtt
qdsfteggyismfyqtrivvplstpksmsmlgfvsacndfsvrllrdtthisqsa

SCOPe Domain Coordinates for d1vbe3_:

Click to download the PDB-style file with coordinates for d1vbe3_.
(The format of our PDB-style files is described here.)

Timeline for d1vbe3_: