Lineage for d4cbyd_ (4cby D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850944Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1850945Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1851223Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 1851257Protein automated matches [190786] (1 species)
    not a true protein
  7. 1851258Species Human (Homo sapiens) [TaxId:9606] [188039] (24 PDB entries)
  8. 1851303Domain d4cbyd_: 4cby D: [234300]
    automated match to d4cbya_
    complexed with kee, na, zn

Details for d4cbyd_

PDB Entry: 4cby (more details), 2.72 Å

PDB Description: design, synthesis, and biological evaluation of potent and selective class iia hdac inhibitors as a potential therapy for huntington's disease
PDB Compounds: (D:) Histone deacetylase 4

SCOPe Domain Sequences for d4cbyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cbyd_ c.42.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttglvydtlmlkhqctcgsssshpehagriqsiwsrlqetglrgkcecirgrkatleelq
tvhseahtllygtnpanrqkldskkllgslasvfvrlpcggvgvdsdtiwnevhsagaar
lavgcvvelvfkvatgelkngfavvrppghhaeestpmgfcyfnsvavaakllqqrlsvs
kilivdwdvhhgngtqqafysdpsvlymslhryddgnffpgsgapdevgtgpgvgfnvnm
aftggldppmgdaeylaafrtvvmpiasefapdvvlvssgfdaveghptplggynlsarc
fgyltkqlmglaggrivlalegghdltaicdaseacvsallgneldplpekvlqqrpnan
avrsmekvmeihskywrclqrhh

SCOPe Domain Coordinates for d4cbyd_:

Click to download the PDB-style file with coordinates for d4cbyd_.
(The format of our PDB-style files is described here.)

Timeline for d4cbyd_: