Lineage for d4c9nb_ (4c9n B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005796Species Novosphingobium aromaticivorans [TaxId:48935] [229374] (3 PDB entries)
  8. 2005800Domain d4c9nb_: 4c9n B: [234296]
    automated match to d4c9oa_
    complexed with cah, cam, gol, hem; mutant

Details for d4c9nb_

PDB Entry: 4c9n (more details), 2.2 Å

PDB Description: Structure of camphor and hydroxycamphor bound D259N mutant of CYP101D1
PDB Compounds: (B:) cytochrome p450

SCOPe Domain Sequences for d4c9nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c9nb_ a.104.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
khrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatrg
tlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkle
dqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrps
gntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralglv
sllllgglntvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryvv
sdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmhl
arlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq

SCOPe Domain Coordinates for d4c9nb_:

Click to download the PDB-style file with coordinates for d4c9nb_.
(The format of our PDB-style files is described here.)

Timeline for d4c9nb_: