Lineage for d4c92d_ (4c92 D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539744Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1539745Protein automated matches [190914] (8 species)
    not a true protein
  7. 1539754Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (6 PDB entries)
  8. 1539759Domain d4c92d_: 4c92 D: [234294]
    automated match to d4m78n_
    protein/RNA complex

Details for d4c92d_

PDB Entry: 4c92 (more details), 2.3 Å

PDB Description: Crystal structure of the yeast Lsm1-7 complex
PDB Compounds: (D:) u6 snrna-associated sm-like protein lsm4

SCOPe Domain Sequences for d4c92d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c92d_ b.38.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
skavklneiyirgtfikfiklqdn

SCOPe Domain Coordinates for d4c92d_:

Click to download the PDB-style file with coordinates for d4c92d_.
(The format of our PDB-style files is described here.)

Timeline for d4c92d_: