Lineage for d4c8xc_ (4c8x C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300542Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1300647Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 1300648Protein automated matches [191113] (5 species)
    not a true protein
  7. 1300670Species Clostridium thermocellum [TaxId:203119] [194259] (4 PDB entries)
  8. 1300676Domain d4c8xc_: 4c8x C: [234293]
    automated match to d4c8xd_
    mutant

Details for d4c8xc_

PDB Entry: 4c8x (more details), 2 Å

PDB Description: Crystal structure of carbohydrate-binding module CBM3b mutant (Y56S) from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum
PDB Compounds: (C:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d4c8xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c8xc_ b.2.2.0 (C:) automated matches {Clostridium thermocellum [TaxId: 203119]}
dvkvqylcentqtstqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficsytpi
gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
kafqdygkvtlykngelvwgtppg

SCOPe Domain Coordinates for d4c8xc_:

Click to download the PDB-style file with coordinates for d4c8xc_.
(The format of our PDB-style files is described here.)

Timeline for d4c8xc_: