Lineage for d4c50b1 (4c50 B:25-432)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741936Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 1741937Protein automated matches [191104] (10 species)
    not a true protein
  7. 1741983Species Mycobacterium tuberculosis [TaxId:83332] [228914] (2 PDB entries)
  8. 1741990Domain d4c50b1: 4c50 B:25-432 [234290]
    automated match to d4c50a1
    complexed with act, glc, hem; mutant

Details for d4c50b1

PDB Entry: 4c50 (more details), 2.5 Å

PDB Description: crystal structure of the catalase-peroxidase (katg) d137s mutant from mycobacterium tuberculosis
PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d4c50b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c50b1 a.93.1.0 (B:25-432) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hmkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieevm
ttsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpsnasldka
rrllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeatw
lgderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndvetaa
livgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtnt
ptkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdlsl
rvdpiyeritrrwlehpeeladefakawyklihrdmgpvarylgplvp

SCOPe Domain Coordinates for d4c50b1:

Click to download the PDB-style file with coordinates for d4c50b1.
(The format of our PDB-style files is described here.)

Timeline for d4c50b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c50b2