SCOPe 2.07: Domain d4bx7b_: 4bx7 B:

Lineage for d4bx7b_ (4bx7 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)

8. Domain d4bx7b_: 4bx7 B: [234283]
   automated match to d4bx6c_
   complexed with b4f, mpd

Details for d4bx7b_

PDB Entry: 4bx7, 2.26 Å

PDB Description: trans-divalent streptavidin bound to biotin-4-fluorescein

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d4bx7b_:

Sequence; same for both SEQRES and ATOM records:

>d4bx7b_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d4bx7b_:

• d4bx7b_ first appeared in SCOPe 2.03
  
• d4bx7b_ appears in SCOPe 2.06
  
• d4bx7b_ appears in the current release, SCOPe 2.08