![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries) |
![]() | Domain d4bx3a1: 4bx3 A:1-290 [234281] Other proteins in same PDB: d4bx3a2 automated match to d4bx3b_ complexed with gol, mg |
PDB Entry: 4bx3 (more details), 2.19 Å
SCOPe Domain Sequences for d4bx3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bx3a1 c.108.1.0 (A:1-290) automated matches {Mouse (Mus musculus) [TaxId: 10090]} marcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsnn srrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglra elraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhpl sdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletdi lfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegl
Timeline for d4bx3a1: