Lineage for d4bx3a1 (4bx3 A:1-290)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920557Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries)
  8. 2920561Domain d4bx3a1: 4bx3 A:1-290 [234281]
    Other proteins in same PDB: d4bx3a2
    automated match to d4bx3b_
    complexed with gol, mg

Details for d4bx3a1

PDB Entry: 4bx3 (more details), 2.19 Å

PDB Description: Crystal Structure of murine Chronophin (Pyridoxal Phosphate Phosphatase)
PDB Compounds: (A:) pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d4bx3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bx3a1 c.108.1.0 (A:1-290) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
marcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsnn
srrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglra
elraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhpl
sdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletdi
lfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegl

SCOPe Domain Coordinates for d4bx3a1:

Click to download the PDB-style file with coordinates for d4bx3a1.
(The format of our PDB-style files is described here.)

Timeline for d4bx3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bx3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4bx3b_