Lineage for d4bpca1 (4bpc A:1368-1688)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1367719Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1367720Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1367797Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 1367981Protein automated matches [190252] (3 species)
    not a true protein
  7. 1367982Species Human (Homo sapiens) [TaxId:9606] [187034] (15 PDB entries)
  8. 1367995Domain d4bpca1: 4bpc A:1368-1688 [234274]
    automated match to d1lara1

Details for d4bpca1

PDB Entry: 4bpc (more details), 2.1 Å

PDB Description: structure of the catalytic domain of protein tyrosine phosphatase sigma in the sulfenic acid form
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase S

SCOPe Domain Sequences for d4bpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bpca1 c.45.1.2 (A:1368-1688) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lshppipiadmaehterlkandslklsqeyesidpgqqftwehsnlevnkpknryanvia
ydhsrvilqpiegimgsdyinanyvdgyrrqnayiatqgplpetfgdfwrmvweqrsati
vmmtrleeksrikcdqywpnrgtetygfiqvtlldtielatfavrtfslhkngssekrev
rqfqftawpdhgvpeyptpflaflrrvktanppdagpivvhcsagvgrtgafividamle
rikpektvdvyghvtlmrsqrnymvqtedqysfihealleavgagntevparslyayiqk
laqvepgehvtgmelefkrla

SCOPe Domain Coordinates for d4bpca1:

Click to download the PDB-style file with coordinates for d4bpca1.
(The format of our PDB-style files is described here.)

Timeline for d4bpca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bpca2