SCOPe 2.05: Domain d1vbd1_: 1vbd 1:

Lineage for d1vbd1_ (1vbd 1:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Poliovirus coat proteins [49666] (3 species)

7. Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries)

8. Domain d1vbd1_: 1vbd 1: [23426]
   complexed with j78, myr

Details for d1vbd1_

PDB Entry: 1vbd, 2.9 Å

PDB Description: poliovirus (type 1, mahoney strain) complexed with r78206

PDB Compounds: (1:) poliovirus type 1 mahoney

SCOPe Domain Sequences for d1vbd1_:

Sequence; same for both SEQRES and ATOM records:

>d1vbd1_ b.121.4.1 (1:) Poliovirus coat proteins {Poliovirus type 3, strain Sabin [TaxId: 12086]}
aatsrdalpnteasgpthskeipaltavetgatnplvpsdtvqtrhvvqhrsrsessies
ffargacvtimtvdnpasttnkdklfavwkitykdtvqlrrklefftysrfdmeltfvvt
anftetnnghalnqvyqimyvppgapvpekwddytwqtssnpsifytygtaparisvpyv
gisnayshfydgfskvplkdqsaalgdslygaaslndfgilavrvvndhnptkvtskirv
ylkpkhirvwcprppravayygpgvdykdgtltplstkdltty

Timeline for d1vbd1_:

• d1vbd1_ first appeared (with stable ids) in SCOP 1.55
  
• d1vbd1_ appears in SCOPe 2.04
  
• d1vbd1_ appears in SCOPe 2.06
  
• d1vbd1_ appears in the current release, SCOPe 2.08