Lineage for d1vbd1_ (1vbd 1:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) 
Protein Poliovirus [49666] (3 species) Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries) 
Domain d1vbd1_: 1vbd 1: [23426]
Details for d1vbd1_
PDB Entry: 1vbd (more details), 2.9 Å
PDB Description: poliovirus (type 1, mahoney strain) complexed with r78206
SCOP Domain Sequences for d1vbd1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbd1_ b.10.1.4 (1:) Poliovirus {Poliovirus type 3, strain Sabin}
aatsrdalpnteasgpthskeipaltavetgatnplvpsdtvqtrhvvqhrsrsessies
ffargacvtimtvdnpasttnkdklfavwkitykdtvqlrrklefftysrfdmeltfvvt
anftetnnghalnqvyqimyvppgapvpekwddytwqtssnpsifytygtaparisvpyv
gisnayshfydgfskvplkdqsaalgdslygaaslndfgilavrvvndhnptkvtskirv
ylkpkhirvwcprppravayygpgvdykdgtltplstkdltty
SCOP Domain Coordinates for d1vbd1_:
Click to download the PDB-style file with coordinates for d1vbd1_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vbd1_:
- d1vbd1_ appears in SCOP 1.57
- d1vbd1_ appears in the current release, SCOPe 2.08
View in 3D
