Lineage for d4bo4c1 (4bo4 C:-5-247)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (244 species)
    not a true protein
  7. 2431988Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (27 PDB entries)
  8. 2432065Domain d4bo4c1: 4bo4 C:-5-247 [234258]
    Other proteins in same PDB: d4bo4a2, d4bo4b2, d4bo4c2, d4bo4d2
    automated match to d4afna_
    complexed with 36g

Details for d4bo4c1

PDB Entry: 4bo4 (more details), 2.7 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4bo4c1:

Sequence, based on SEQRES records: (download)

>d4bo4c1 c.2.1.0 (C:-5-247) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
nlyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangv
egaglvldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnl
nslyrlskavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgs
raitvnavapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvt
gatvpvnggmyms

Sequence, based on observed residues (ATOM records): (download)

>d4bo4c1 c.2.1.0 (C:-5-247) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
nlyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangv
egaglvldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnl
nslyrlskavlrgmtkarwgriinigsvvggnagqtnyaaakaglegftralarevgsra
itvnavapgfidtdmtreaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvp
vnggmyms

SCOPe Domain Coordinates for d4bo4c1:

Click to download the PDB-style file with coordinates for d4bo4c1.
(The format of our PDB-style files is described here.)

Timeline for d4bo4c1: