Lineage for d4bo5a_ (4bo5 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350904Species Pseudomonas aeruginosa [TaxId:208964] [196452] (24 PDB entries)
  8. 1350967Domain d4bo5a_: 4bo5 A: [234251]
    automated match to d4afna_
    complexed with ni, wi4

Details for d4bo5a_

PDB Entry: 4bo5 (more details), 2.6 Å

PDB Description: Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (FabG) from Pseudomonas aeruginosa in complex with N-(2-chlorophenyl)-4- pyrrol-1-yl-1,3,5-triazin-2-amine at 2.6A resolution
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4bo5a_:

Sequence, based on SEQRES records: (download)

>d4bo5a_ c.2.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
lyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangve
gaglvldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnln
slyrlskavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsr
aitvnavapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtg
atvpvnggmyms

Sequence, based on observed residues (ATOM records): (download)

>d4bo5a_ c.2.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
lyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangve
gaglvldvssdesvaatlehiqqhlgqplivvnnagitrdndewfdvvntnlnslyrlsk
avlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvnav
apgfidtqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpvnggmyms

SCOPe Domain Coordinates for d4bo5a_:

Click to download the PDB-style file with coordinates for d4bo5a_.
(The format of our PDB-style files is described here.)

Timeline for d4bo5a_:

  • d4bo5a_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-12
  • d4bo5a_ appears in SCOPe 2.04
  • d4bo5a_ appears in the current release, SCOPe 2.07, called d4bo5a1