Lineage for d4bnxb1 (4bnx B:1-246)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108430Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (27 PDB entries)
  8. 2108486Domain d4bnxb1: 4bnx B:1-246 [234220]
    Other proteins in same PDB: d4bnxa2, d4bnxb2, d4bnxc2, d4bnxd2
    automated match to d4afna_
    complexed with o74

Details for d4bnxb1

PDB Entry: 4bnx (more details), 2.3 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4bnxb1:

Sequence, based on SEQRES records: (download)

>d4bnxb1 c.2.1.0 (B:1-246) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnlnslyrl
skavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvn
avapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpv
nggmym

Sequence, based on observed residues (ATOM records): (download)

>d4bnxb1 c.2.1.0 (B:1-246) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnamkddewfdvvntnlnslyrlskavlrgmtk
arwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvnavapgfidtd
mtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpvnggmym

SCOPe Domain Coordinates for d4bnxb1:

Click to download the PDB-style file with coordinates for d4bnxb1.
(The format of our PDB-style files is described here.)

Timeline for d4bnxb1: