Lineage for d4bnud1 (4bnu D:1-247)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095624Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (27 PDB entries)
  8. 2095650Domain d4bnud1: 4bnu D:1-247 [234219]
    Other proteins in same PDB: d4bnua2, d4bnub2, d4bnuc2, d4bnud2
    automated match to d4afna_
    complexed with 9kq

Details for d4bnud1

PDB Entry: 4bnu (more details), 2 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2-phenyl-4-(1,2,4- triazol-4-yl)quinazoline at 2.0a resolution
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4bnud1:

Sequence, based on SEQRES records: (download)

>d4bnud1 c.2.1.0 (D:1-247) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnlnslyrl
skavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvn
avapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpv
nggmyms

Sequence, based on observed residues (ATOM records): (download)

>d4bnud1 c.2.1.0 (D:1-247) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnagivrmkddewfdvvntnlnslyrlskavlr
gmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvnavapgf
idtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpvnggmym
s

SCOPe Domain Coordinates for d4bnud1:

Click to download the PDB-style file with coordinates for d4bnud1.
(The format of our PDB-style files is described here.)

Timeline for d4bnud1: