Lineage for d4bnva1 (4bnv A:1-246)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848075Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (30 PDB entries)
  8. 2848151Domain d4bnva1: 4bnv A:1-246 [234218]
    Other proteins in same PDB: d4bnva2, d4bnvc2, d4bnvd2
    automated match to d4afna_
    complexed with q7u

Details for d4bnva1

PDB Entry: 4bnv (more details), 2.5 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(2-chlorophenyl)-3-(1- methylbenzimidazol-2-yl)urea at 2.5a resolution
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4bnva1:

Sequence, based on SEQRES records: (download)

>d4bnva1 c.2.1.0 (A:1-246) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnlnslyrl
skavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvn
avapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpv
nggmym

Sequence, based on observed residues (ATOM records): (download)

>d4bnva1 c.2.1.0 (A:1-246) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnagiewfdvvntnlnslyrlskavlrgmtkar
wgriinigsvvggqtnyaaakaglegftralarevgsraitvnavapgfidtdmtrelpe
aqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpvnggmym

SCOPe Domain Coordinates for d4bnva1:

Click to download the PDB-style file with coordinates for d4bnva1.
(The format of our PDB-style files is described here.)

Timeline for d4bnva1: