Lineage for d4bm7b2 (4bm7 B:342-445)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295895Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)
  8. 1295906Domain d4bm7b2: 4bm7 B:342-445 [234200]
    automated match to d1igtb4
    complexed with cl; mutant

Details for d4bm7b2

PDB Entry: 4bm7 (more details), 1.95 Å

PDB Description: crystal structure of igg fc f241a mutant with native glycosylation
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4bm7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bm7b2 b.1.1.0 (B:342-445) automated matches {Homo sapiens [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

SCOPe Domain Coordinates for d4bm7b2:

Click to download the PDB-style file with coordinates for d4bm7b2.
(The format of our PDB-style files is described here.)

Timeline for d4bm7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bm7b1