Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) |
Protein Poliovirus [49666] (3 species) |
Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries) |
Domain d1vbb1_: 1vbb 1: [23420] |
PDB Entry: 1vbb (more details), 2.8 Å
SCOP Domain Sequences for d1vbb1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbb1_ b.10.1.4 (1:) Poliovirus {Poliovirus type 3, strain Sabin} qdslpdtkasgpahskevpaltavetgatnplapsdtvqtrhvvqrrsrsestiesffar gacvaiievdneqpttraqklfamwritykdtvqlrrklefftysrfdmeftfvvtanft nannghalnqvyqimyippgaptpkswddytwqtssnpsifytygaaparisvpyvglan ayshfydgfakvplktdandqigdslysamtvddfgvlavrvvndhnptkvtskvriymk pkhvrvwcprppravpyygpgvdyrnnldplsekgltty
Timeline for d1vbb1_: