Lineage for d4bm7a1 (4bm7 A:237-341)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032308Domain d4bm7a1: 4bm7 A:237-341 [234197]
    automated match to d1igtb3
    complexed with cl; mutant

Details for d4bm7a1

PDB Entry: 4bm7 (more details), 1.95 Å

PDB Description: crystal structure of igg fc f241a mutant with native glycosylation
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4bm7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bm7a1 b.1.1.0 (A:237-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvalfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d4bm7a1:

Click to download the PDB-style file with coordinates for d4bm7a1.
(The format of our PDB-style files is described here.)

Timeline for d4bm7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bm7a2