SCOPe 2.05: Domain d4bkmb_: 4bkm B:

Lineage for d4bkmb_ (4bkm B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (49 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [193863] (7 PDB entries)

8. Domain d4bkmb_: 4bkm B: [234195]
   automated match to d4bx3b_
   complexed with mg, no3

Details for d4bkmb_

PDB Entry: 4bkm, 2.5 Å

PDB Description: crystal structure of the murine aum (phosphoglycolate phosphatase) capping domain as a fusion protein with the catalytic core domain of murine chronophin (pyridoxal phosphate phosphatase)

PDB Compounds: (B:) pyridoxal phosphate phosphatase, phosphoglycolate phosphatase, pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d4bkmb_:

Sequence; same for both SEQRES and ATOM records:

>d4bkmb_ c.108.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspalaae
leavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylqqpd
cllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfsvdp
artlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadl
megl

Timeline for d4bkmb_:

• d4bkmb_ first appeared in SCOPe 2.03
  
• d4bkmb_ appears in SCOPe 2.04
  
• d4bkmb_ appears in SCOPe 2.06
  
• d4bkmb_ appears in the current release, SCOPe 2.08