Lineage for d4bkmb_ (4bkm B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1629211Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1629212Protein automated matches [190447] (45 species)
    not a true protein
  7. 1629463Species Mouse (Mus musculus) [TaxId:10090] [193863] (6 PDB entries)
  8. 1629474Domain d4bkmb_: 4bkm B: [234195]
    automated match to d4bx3b_
    complexed with mg, no3

Details for d4bkmb_

PDB Entry: 4bkm (more details), 2.5 Å

PDB Description: crystal structure of the murine aum (phosphoglycolate phosphatase) capping domain as a fusion protein with the catalytic core domain of murine chronophin (pyridoxal phosphate phosphatase)
PDB Compounds: (B:) pyridoxal phosphate phosphatase, phosphoglycolate phosphatase, pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d4bkmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bkmb_ c.108.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlagvpdpkayvlgspalaae
leavgvtsvgvgpdvlhgdgpsdwlavplepdvravvvgfdphfsymkltkavrylqqpd
cllvgtnmdnrlplengrfiagtgclvravemaaqrqadiigkpspymfqcitedfsvdp
artlmvgdrletdilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadl
megl

SCOPe Domain Coordinates for d4bkmb_:

Click to download the PDB-style file with coordinates for d4bkmb_.
(The format of our PDB-style files is described here.)

Timeline for d4bkmb_: