Lineage for d4bjkc_ (4bjk C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278293Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (6 PDB entries)
  8. 1278316Domain d4bjkc_: 4bjk C: [234188]
    automated match to d4bjkb_
    complexed with 18i, hem

Details for d4bjkc_

PDB Entry: 4bjk (more details), 2.67 Å

PDB Description: CYP51 of Trypanosoma brucei bound to (S)-N-(3-(1H-indol-3-yl)-1-oxo-1- (pyridin-4-ylamino)propan-2-yl)-3,3'-difluoro-(1,1'-biphenyl)-4- carboxamide
PDB Compounds: (C:) lanosterol 14-alpha-demethylase

SCOPe Domain Sequences for d4bjkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bjkc_ a.104.1.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gklppmypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsr
fflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmessl
ipaavflpillklplpqsarcheartelqkilseiiiarkaaavnkdsstsdllsgllsa
vyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpa
qlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllsh
hdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqll
rdevpdpdyhtmvvgptasqcrvkyirrka

SCOPe Domain Coordinates for d4bjkc_:

Click to download the PDB-style file with coordinates for d4bjkc_.
(The format of our PDB-style files is described here.)

Timeline for d4bjkc_:

  • d4bjkc_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-12
  • d4bjkc_ appears in SCOPe 2.04
  • d4bjkc_ appears in the current release, SCOPe 2.07, called d4bjkc1