Class b: All beta proteins [48724] (174 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
Protein automated matches [190537] (7 species) not a true protein |
Species Danio rerio [TaxId:7955] [229041] (1 PDB entry) |
Domain d4bj8l_: 4bj8 L: [234183] automated match to d4bj8e_ complexed with btn, gol |
PDB Entry: 4bj8 (more details), 2.4 Å
SCOPe Domain Sequences for d4bj8l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bj8l_ b.61.1.0 (L:) automated matches {Danio rerio [TaxId: 7955]} sscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqpt vsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffktg v
Timeline for d4bj8l_: