Lineage for d4bj8k_ (4bj8 K:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1801299Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 1801300Protein automated matches [190537] (8 species)
    not a true protein
  7. 1801368Species Zebrafish (Danio rerio) [TaxId:7955] [229041] (1 PDB entry)
  8. 1801379Domain d4bj8k_: 4bj8 K: [234181]
    automated match to d4bj8e_
    complexed with btn, gol

Details for d4bj8k_

PDB Entry: 4bj8 (more details), 2.4 Å

PDB Description: zebavidin
PDB Compounds: (K:) zebavidin

SCOPe Domain Sequences for d4bj8k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bj8k_ b.61.1.0 (K:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
vsscnvtgvwrnelgstlrvkaegsevrgvyqtavestrgaaghhrsariigmvsdgtqp
tvsfsvlwekgscsawvgqcfilddgaqvlktfwmlrsvadnlasawgstrmgediffkt

SCOPe Domain Coordinates for d4bj8k_:

Click to download the PDB-style file with coordinates for d4bj8k_.
(The format of our PDB-style files is described here.)

Timeline for d4bj8k_: