Lineage for d1pvc1_ (1pvc 1:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 protein domains)
  6. 11648Protein Poliovirus [49666] (3 species)
  7. 11684Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries)
  8. 11685Domain d1pvc1_: 1pvc 1: [23417]

Details for d1pvc1_

PDB Entry: 1pvc (more details), 2.4 Å

PDB Description: refinement of the sabin strain of type 3 poliovirus at 2.4 angstroms and the crystal structures of its variants at 2.9 angstroms resolution

SCOP Domain Sequences for d1pvc1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvc1_ b.10.1.4 (1:) Poliovirus {Poliovirus type 3, strain Sabin}
qdslpdtkasgpahskevpaltavetgatnplapsdtvqtrhvvqrrsrsestiesffar
gacvaiievdneqpttraqklfamwritykdtvqlrrklefftysrfdmeftfvvtanft
nannghalnqvyqimyippgaptpkswddytwqtssnpsifytygaaparisvpyvglan
ayshfydgfakvplktdandqigdslysamtvddfgvlavrvvndhnptkvtskvriymk
pkhvrvwcprppravpyygpgvdyrnnldplsekgltty

SCOP Domain Coordinates for d1pvc1_:

Click to download the PDB-style file with coordinates for d1pvc1_.
(The format of our PDB-style files is described here.)

Timeline for d1pvc1_: