Lineage for d4bhtc1 (4bht C:6-196)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890709Species Escherichia coli [TaxId:562] [234160] (3 PDB entries)
  8. 2890712Domain d4bhtc1: 4bht C:6-196 [234167]
    Other proteins in same PDB: d4bhta2, d4bhtb2, d4bhtc2, d4bhtd2, d4bhte2, d4bhtf2
    automated match to d4fcca1
    complexed with epe, gol, pg4

Details for d4bhtc1

PDB Entry: 4bht (more details), 2.5 Å

PDB Description: Structural Determinants of Cofactor Specificity and Domain Flexibility in Bacterial Glutamate Dehydrogenases
PDB Compounds: (C:) NADP-specific glutamate dehydrogenase

SCOPe Domain Sequences for d4bhtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bhtc1 c.58.1.0 (C:6-196) automated matches {Escherichia coli [TaxId: 562]}
slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
lsnntacvftg

SCOPe Domain Coordinates for d4bhtc1:

Click to download the PDB-style file with coordinates for d4bhtc1.
(The format of our PDB-style files is described here.)

Timeline for d4bhtc1: