Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (23 species) not a true protein |
Species Escherichia coli [TaxId:562] [234160] (1 PDB entry) |
Domain d4bhtd1: 4bht D:6-196 [234165] Other proteins in same PDB: d4bhta2, d4bhtb2, d4bhtc2, d4bhtd2, d4bhte2, d4bhtf2 automated match to d4fcca1 complexed with epe, gol, pg4 |
PDB Entry: 4bht (more details), 2.5 Å
SCOPe Domain Sequences for d4bhtd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bhtd1 c.58.1.0 (D:6-196) automated matches {Escherichia coli [TaxId: 562]} slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk lsnntacvftg
Timeline for d4bhtd1: