SCOPe 2.05: Domain d4bhtd1: 4bht D:6-196

Lineage for d4bhtd1 (4bht D:6-196)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [234160] (1 PDB entry)

8. Domain d4bhtd1: 4bht D:6-196 [234165]
   Other proteins in same PDB: d4bhta2, d4bhtb2, d4bhtc2, d4bhtd2, d4bhte2, d4bhtf2
   automated match to d4fcca1
   complexed with epe, gol, pg4

Details for d4bhtd1

PDB Entry: 4bht, 2.5 Å

PDB Description: Structural Determinants of Cofactor Specificity and Domain Flexibility in Bacterial Glutamate Dehydrogenases

PDB Compounds: (D:) NADP-specific glutamate dehydrogenase

SCOPe Domain Sequences for d4bhtd1:

Sequence; same for both SEQRES and ATOM records:

>d4bhtd1 c.58.1.0 (D:6-196) automated matches {Escherichia coli [TaxId: 562]}
slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
lsnntacvftg

Timeline for d4bhtd1:

• d4bhtd1 first appeared in SCOPe 2.03
  
• d4bhtd1 appears in SCOPe 2.04
  
• d4bhtd1 appears in SCOPe 2.06
  
• d4bhtd1 appears in the current release, SCOPe 2.08