Lineage for d1eah3_ (1eah 3:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) 
Protein Poliovirus [49666] (3 species) 
Species Poliovirus type 2, strain Lansing [TaxId:12083] [49668] (1 PDB entry) 
Domain d1eah3_: 1eah 3: [23416]
Details for d1eah3_
PDB Entry: 1eah (more details), 2.9 Å
PDB Description: pv2l complexed with antiviral agent sch48973
SCOP Domain Sequences for d1eah3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eah3_ b.10.1.4 (3:) Poliovirus {Poliovirus type 2, strain Lansing}
glpvlntpgsnqyltadnyqspcaipefdvtppidipgevrnmmelaeidtmiplnltnq
rkntmdmyrvelndaahsdtpilclslspasdprlahtmlgeilnyythwagslkftflf
cgsmmatgkllvsyappgaeapksrkeamlgthviwdiglqssctmvvpwisnttyrqti
ndsfteggyismfyqtrvvvplstprkmdilgfvsacndfsvrllrdtthisqea
SCOP Domain Coordinates for d1eah3_:
Click to download the PDB-style file with coordinates for d1eah3_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eah3_:
- d1eah3_ appears in SCOP 1.57
- d1eah3_ appears in the current release, SCOPe 2.08
View in 3D
