SCOPe 2.05: Domain d4bflb2: 4bfl B:598-753

Lineage for d4bflb2 (4bfl B:598-753)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)

6. Protein Catalase, C-terminal domain [52329] (2 species)

7. Species Escherichia coli, HPII [TaxId:562] [52330] (16 PDB entries)

8. Domain d4bflb2: 4bfl B:598-753 [234156]
   Other proteins in same PDB: d4bfla1, d4bflb1, d4bflc1, d4bfld1
   automated match to d4bfld2
   complexed with edo, hem

Details for d4bflb2

PDB Entry: 4bfl, 1.64 Å

PDB Description: Structure of natively expressed catalase HPII

PDB Compounds: (B:) catalase hpii

SCOPe Domain Sequences for d4bflb2:

Sequence; same for both SEQRES and ATOM records:

>d4bflb2 c.23.16.3 (B:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d4bflb2:

• d4bflb2 first appeared in SCOPe 2.03
  
• d4bflb2 appears in SCOPe 2.04
  
• d4bflb2 appears in SCOPe 2.06
  
• d4bflb2 appears in the current release, SCOPe 2.08