Lineage for d4bflb1 (4bfl B:9-597)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570066Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2570067Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2570068Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2570157Protein Catalase II [56642] (1 species)
    contains additional flavodoxin-like domain at C-terminus
  7. 2570158Species Escherichia coli, HPII [TaxId:562] [56643] (17 PDB entries)
  8. 2570164Domain d4bflb1: 4bfl B:9-597 [234155]
    Other proteins in same PDB: d4bfla2, d4bflb2, d4bflc2, d4bfld2
    automated match to d4bfld1
    complexed with edo, hem

Details for d4bflb1

PDB Entry: 4bfl (more details), 1.64 Å

PDB Description: Structure of natively expressed catalase HPII
PDB Compounds: (B:) catalase hpii

SCOPe Domain Sequences for d4bflb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bflb1 e.5.1.1 (B:9-597) Catalase II {Escherichia coli, HPII [TaxId: 562]}
phqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdtrneklnsl
edvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdheriperivh
argsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatk
fyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpe
tlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaq
kltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvq
rvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnf
heipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrggfesyqer
vegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqla
hidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgd

SCOPe Domain Coordinates for d4bflb1:

Click to download the PDB-style file with coordinates for d4bflb1.
(The format of our PDB-style files is described here.)

Timeline for d4bflb1: