Lineage for d4bd7a_ (4bd7 A:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1695625Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1695694Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1695905Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 1695906Protein automated matches [195066] (2 species)
    not a true protein
  7. 1695907Species Human (Homo sapiens) [TaxId:9606] [225196] (8 PDB entries)
  8. 1695917Domain d4bd7a_: 4bd7 A: [234150]
    automated match to d2yv6a_
    complexed with cl, pr

Details for d4bd7a_

PDB Entry: 4bd7 (more details), 2.9 Å

PDB Description: Bax domain swapped dimer induced by octylmaltoside
PDB Compounds: (A:) Apoptosis regulator BAX

SCOPe Domain Sequences for d4bd7a_:

Sequence, based on SEQRES records: (download)

>d4bd7a_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseslkrigdeldsn
melqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvpeli
rtimgwtldflrerllgwiqdqggwdgllsyfgtptw

Sequence, based on observed residues (ATOM records): (download)

>d4bd7a_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsseqimktgalllqgfiqdragrpqdastkklseslkrigdeldsnmelqrmiaavdtd
sprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvpelirtimgwtldflre
rllgwiqdqggwdgllsyfgtptw

SCOPe Domain Coordinates for d4bd7a_:

Click to download the PDB-style file with coordinates for d4bd7a_.
(The format of our PDB-style files is described here.)

Timeline for d4bd7a_: