Lineage for d4bbxb_ (4bbx B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350180Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2350181Protein automated matches [190983] (10 species)
    not a true protein
  7. 2350200Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)
  8. 2350477Domain d4bbxb_: 4bbx B: [234148]
    automated match to d3wi2a_
    complexed with lkf, mg, zn

Details for d4bbxb_

PDB Entry: 4bbx (more details), 2.5 Å

PDB Description: Discovery of a potent, selective and orally active PDE10A inhibitor for the treatment of schizophrenia
PDB Compounds: (B:) camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a

SCOPe Domain Sequences for d4bbxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bbxb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
yfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefw
aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
nlsqwekvirge

SCOPe Domain Coordinates for d4bbxb_:

Click to download the PDB-style file with coordinates for d4bbxb_.
(The format of our PDB-style files is described here.)

Timeline for d4bbxb_: