SCOPe 2.08: Domain d4bbob_: 4bbo B:

Lineage for d4bbob_ (4bbo B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (10 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:375] [228284] (2 PDB entries)

8. Domain d4bbob_: 4bbo B: [234146]
   automated match to d4bbod_
   complexed with act, btn, gol

Details for d4bbob_

PDB Entry: 4bbo, 1.6 Å

PDB Description: crystal structure of core-bradavidin

PDB Compounds: (B:) blr5658 protein

SCOPe Domain Sequences for d4bbob_:

Sequence; same for both SEQRES and ATOM records:

>d4bbob_ b.61.1.0 (B:) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
qsvnwtwtnqygstlaitsfnsntgaitgtytnnaanscdegkpqgvtgwlaygntgtai
sfsvnflgcgsttvwtgqlnnatgfqglwylslaeavawngisagadtftfss

Timeline for d4bbob_:

• d4bbob_ first appeared in SCOPe 2.03
  
• d4bbob_ appears in SCOPe 2.07