Lineage for d4bbna1 (4bbn A:519-895)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548233Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 2548234Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 2548250Family d.148.1.0: automated matches [227207] (1 protein)
    not a true family
  6. 2548251Protein automated matches [226939] (2 species)
    not a true protein
  7. 2548255Species Human (Homo sapiens) [TaxId:9606] [225255] (16 PDB entries)
  8. 2548259Domain d4bbna1: 4bbn A:519-895 [234144]
    Other proteins in same PDB: d4bbna2, d4bbnc_, d4bbnf_
    automated match to d2onia_

Details for d4bbna1

PDB Entry: 4bbn (more details), 2.51 Å

PDB Description: nedd4 hect-ub:ub complex
PDB Compounds: (A:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d4bbna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bbna1 d.148.1.0 (A:519-895) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefd
gekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsginpdhlsyfkfig
rvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldlr
fiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffel
ipqdlikifdenelellmsglgdvdvndwrehtkykngysanhqviqwfwkavlmmdsek
rirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlppyesf
eelwdklqmaientqgf

SCOPe Domain Coordinates for d4bbna1:

Click to download the PDB-style file with coordinates for d4bbna1.
(The format of our PDB-style files is described here.)

Timeline for d4bbna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bbna2